Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057871-protein ID=TCONS_00057871-protein|Name=TCONS_00057871-protein|organism=Clytia hemisphaerica|type=polypeptide|length=101bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057871-protein vs. Swiss-Prot (Human)
Match: DCXR (L-xylulose reductase OS=Homo sapiens GN=DCXR PE=1 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 9.913e-17 Identity = 39/95 (41.05%), Postives = 57/95 (60.00%), Query Frame = 0 Query: 1 YCMSKAALDQFTRAAAIELGADQVRVNCVNPSIIATEKC-SNSSDPSVKAAMERSKMTHALGRAGTVDEVAAAILFLASGAASYITGATFPIDGG 94 YC +K ALD T+ A+ELG ++RVN VNP+++ T + SDP KA +++ LG+ V+ V AILFL S + TG+T P++GG Sbjct: 149 YCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPH-KAKTMLNRI--PLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG 240 The following BLAST results are available for this feature:
BLAST of TCONS_00057871-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|