Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00058973-protein ID=TCONS_00058973-protein|Name=TCONS_00058973-protein|organism=Clytia hemisphaerica|type=polypeptide|length=383bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00058973-protein vs. Swiss-Prot (Human)
Match: SOX14 (Transcription factor SOX-14 OS=Homo sapiens GN=SOX14 PE=1 SV=1) HSP 1 Score: 122.479 bits (306), Expect = 9.744e-33 Identity = 47/82 (57.32%), Postives = 70/82 (85.37%), Query Frame = 0 Query: 56 TDHVKRPMNAFMVWSQIERKKMAESYPDMHNAEISRRLGKQWKMLTDDDRRPYVIRSEKLREEHMRRHPDYKYRPKKKAKEM 137 +DH+KRPMNAFMVWS+ +R+KMA+ P MHN+EIS+RLG +WK+L++ ++RPY+ +++LR +HM+ HPDYKYRP++K K + Sbjct: 5 SDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNL 86 The following BLAST results are available for this feature:
BLAST of TCONS_00058973-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|