Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00062359-protein ID=TCONS_00062359-protein|Name=TCONS_00062359-protein|organism=Clytia hemisphaerica|type=polypeptide|length=112bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00062359-protein vs. Swiss-Prot (Human)
Match: EMC6 (ER membrane protein complex subunit 6 OS=Homo sapiens GN=EMC6 PE=1 SV=1) HSP 1 Score: 95.5153 bits (236), Expect = 7.125e-27 Identity = 56/114 (49.12%), Postives = 82/114 (71.93%), Query Frame = 0 Query: 1 MAA--ESEEIPGFEFEAYNPFAIRSNSALVEYCRAFLAFVSGSAAGILGLTGLNGFFFYMIASIFMSVLLGLKTQSQWDRYFLSKWHVWTNGIFGELFTYLLVWTFMYGIIHVF 112 MAA E P F EA A+R N+A+++YCR ++ +SG+ AGILGLTGL GF FY++AS+ +S+LL LK +W++YF S+ ++T G+ G LFTY+L WTF+YG++HV+ Sbjct: 1 MAAVVAKREGPPFISEA----AVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY 110 The following BLAST results are available for this feature:
BLAST of TCONS_00062359-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|