Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00063939-protein ID=TCONS_00063939-protein|Name=TCONS_00063939-protein|organism=Clytia hemisphaerica|type=polypeptide|length=506bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00063939-protein vs. Swiss-Prot (Human)
Match: AEBP2 (Zinc finger protein AEBP2 OS=Homo sapiens GN=AEBP2 PE=1 SV=2) HSP 1 Score: 98.5969 bits (244), Expect = 6.484e-22 Identity = 44/95 (46.32%), Postives = 60/95 (63.16%), Query Frame = 0 Query: 225 NCEWGDCRLSFINAEDLTDHVESSHLVSCEESDNCSCMWRDCKFLNQ-SCSFKWLSKHVLRHCDLKPFKCVILGCDMTFSTQNGLARHVPTHFNE 318 NC W C+ F ++ DL DH+ S H V + C+W+ CK N S S WL +H+L H KPFKCV+ GC+ +F++Q GLARHVPTHF++ Sbjct: 262 NCCWDQCQACFNSSPDLADHIRSIH-VDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQ 355 The following BLAST results are available for this feature:
BLAST of TCONS_00063939-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|