Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00069781-protein ID=TCONS_00069781-protein|Name=TCONS_00069781-protein|organism=Clytia hemisphaerica|type=polypeptide|length=581bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00069781-protein vs. Swiss-Prot (Human)
Match: LST2 (Lateral signaling target protein 2 homolog OS=Homo sapiens GN=ZFYVE28 PE=1 SV=3) HSP 1 Score: 81.6481 bits (200), Expect = 3.861e-16 Identity = 32/64 (50.00%), Postives = 41/64 (64.06%), Query Frame = 0 Query: 512 WIPDDLVHECQISKCRAPFTKTTRKHHCRCCGRVFCAKCSQQKVKLERFGYTKPVRVCNVCYAL 575 W+PD+ C + C+APFT RKHHCR CG++FC++CS L R+G KPVRVC CY Sbjct: 814 WVPDEACGFC--TACKAPFTVIRRKHHCRSCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMF 875 The following BLAST results are available for this feature:
BLAST of TCONS_00069781-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|