Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00046838 ID=TCONS_00046838|Name=TCONS_00046838|organism=Clytia hemisphaerica|type=transcript|length=645bpRun BLAST on NCBI protein sequence of TCONS_00046838-protein >TCONS_00046838-protein ID=TCONS_00046838-protein|Name=TCONS_00046838-protein|organism=Clytia hemisphaerica|type=polypeptide|length=161bp NKVNPGLSNCERNTKECFKLQAKYKFFLAVENFYCTDYVTEKFYEESLRKRun BLAST on NCBI transcript from alignment at scaffold_117:150666..151310 Legend: exonthree_prime_UTRCDSfive_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00046838 ID=TCONS_00046838|Name=TCONS_00046838|organism=Clytia hemisphaerica|type=transcript|length=645bp|location=Sequence derived from alignment at scaffold_117:150666..151310 (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_117:150666..151310 >TCONS_00046838 ID=TCONS_00046838|Name=TCONS_00046838|organism=Clytia hemisphaerica|type=CDS|length=486bp|location=Sequence derived from alignment at scaffold_117:150666..151310 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
BLAST of TCONS_00046838 vs. Swiss-Prot (Human)
Match: FUT4 (Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens GN=FUT4 PE=2 SV=3) HSP 1 Score: 85.5001 bits (210), Expect = 4.319e-19 Identity = 42/115 (36.52%), Postives = 65/115 (56.52%), Query Frame = 3 Query: 66 AKYKFFLAVENFYCTDYVTEKFYEESLRKGLVPVMINGGKLRNRRIAPPHSYINVLDFKNAKELADYINYLDRNQTAYLEYHKWRRDYEIVPHNY----KCNLCRSINKKFNRVK 398 A+YKF+LA EN DY+TEK + +L G VPV++ + R P ++I+V DF +A LA Y+ +LDRN Y Y WRR Y + ++ C +C+++ + +R K Sbjct: 405 ARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPK 519 The following BLAST results are available for this feature:
BLAST of TCONS_00046838 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|