Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00057716 ID=TCONS_00057716|Name=TCONS_00057716|organism=Clytia hemisphaerica|type=transcript|length=544bpRun BLAST on NCBI transcript from alignment at scaffold_297:239838..240381 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00057716 ID=TCONS_00057716|Name=TCONS_00057716|organism=Clytia hemisphaerica|type=transcript|length=544bp|location=Sequence derived from alignment at scaffold_297:239838..240381 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00057716 vs. Swiss-Prot (Human)
Match: MTF1 (Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2) HSP 1 Score: 81.6481 bits (200), Expect = 7.953e-18 Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = -1 Query: 215 ESKAFSCTIDGCNRTYKTKGNLKTHMKIHSGEFSFYCDYEGCEKGFVSAYSFKVHYRHHT 394 E K + CT +GC RTY T GNL+TH K H GE++F C+ EGC K F+++YS ++H R HT Sbjct: 136 EVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKAFLTSYSLRIHVRVHT 195 The following BLAST results are available for this feature:
BLAST of TCONS_00057716 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|