Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00003489-protein ID=TCONS_00003489-protein|Name=TCONS_00003489-protein|organism=Clytia hemisphaerica|type=polypeptide|length=100bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00003489-protein vs. Swiss-Prot (Human)
Match: VAMP3 (Vesicle-associated membrane protein 3 OS=Homo sapiens GN=VAMP3 PE=1 SV=3) HSP 1 Score: 124.79 bits (312), Expect = 6.992e-39 Identity = 62/81 (76.54%), Postives = 69/81 (85.19%), Query Frame = 0 Query: 1 MSSEKTPITGDNK-LQQTQKQVDQVVDIMRQNMDKVLERDSKLSELDNRADALQAGASQFETNAGKLKRKMWWQNCKMWII 80 MS+ T TG N+ LQQTQ QVD+VVDIMR N+DKVLERD KLSELD+RADALQAGASQFET+A KLKRK WW+NCKMW I Sbjct: 1 MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAI 81 The following BLAST results are available for this feature:
BLAST of TCONS_00003489-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|