Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00053612-protein ID=TCONS_00053612-protein|Name=putative Pdx/Xlox homeodomain transcription factor|organism=Clytia hemisphaerica|type=polypeptide|length=350bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of putative Pdx/Xlox homeodomain transcription factor vs. Swiss-Prot (Human)
Match: HXB7 (Homeobox protein Hox-B7 OS=Homo sapiens GN=HOXB7 PE=1 SV=4) HSP 1 Score: 95.9005 bits (237), Expect = 2.688e-23 Identity = 44/71 (61.97%), Postives = 53/71 (74.65%), Query Frame = 0 Query: 274 RKRSRTTYTRAQQLELEKEYRYNRYISRARRIELAKNLTLTEKHIKIWYQNRRMKEKRDEEDIMRGTTVLD 344 RKR R TYTR Q LELEKE+ YNRY++R RRIE+A L LTE+ IKIW+QNRRMK K++ + GTT D Sbjct: 137 RKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQD 207 The following BLAST results are available for this feature:
BLAST of putative Pdx/Xlox homeodomain transcription factor vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|