Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057378-protein ID=TCONS_00057378-protein|Name=TCONS_00057378-protein|organism=Clytia hemisphaerica|type=polypeptide|length=171bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057378-protein vs. Swiss-Prot (Human)
Match: RM28 (39S ribosomal protein L28, mitochondrial OS=Homo sapiens GN=MRPL28 PE=1 SV=4) HSP 1 Score: 76.6406 bits (187), Expect = 1.757e-17 Identity = 40/96 (41.67%), Postives = 54/96 (56.25%), Query Frame = 0 Query: 25 YISPENNAGIWHGASVKSGFTETFSGKKTKRF---WYPNVSEKEIYSDILDEKIKTTFTAKALREIDNAGGFDNYIMRTPDKVLCSNFAIELKRQM 117 Y PE+ G+W G G + K +KR W P + E+E YS+ILD+K T T + L ID A G D YI++TP + LCS F ++LKR M Sbjct: 70 YFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGM 165 The following BLAST results are available for this feature:
BLAST of TCONS_00057378-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|