Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00051857 ID=TCONS_00051857|Name=TCONS_00051857|organism=Clytia hemisphaerica|type=transcript|length=1142bpRun BLAST on NCBI protein sequence of TCONS_00051857-protein >TCONS_00051857-protein ID=TCONS_00051857-protein|Name=TCONS_00051857-protein|organism=Clytia hemisphaerica|type=polypeptide|length=371bp XISNPNVAPEDDEKFLYGENSEKKSSQENGDAEMKDVNGNAGGEDEDEFERun BLAST on NCBI transcript from alignment at scaffold_205:93501..105803- Legend: exonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00051857 ID=TCONS_00051857|Name=TCONS_00051857|organism=Clytia hemisphaerica|type=transcript|length=12303bp|location=Sequence derived from alignment at scaffold_205:93501..105803- (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_205:93501..105803- >TCONS_00051857 ID=TCONS_00051857|Name=TCONS_00051857|organism=Clytia hemisphaerica|type=CDS|length=13392bp|location=Sequence derived from alignment at scaffold_205:93501..105803- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
Blast
BLAST of TCONS_00051857 vs. Swiss-Prot (Human)
Match: FIP1 (Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens GN=FIP1L1 PE=1 SV=1) HSP 1 Score: 93.2041 bits (230), Expect = 1.537e-20 Identity = 39/62 (62.90%), Postives = 51/62 (82.26%), Query Frame = 1 Query: 355 KKIDVNAVGQINGQPIYEFDMDAEQDEKAWRKPGADISDYFNYGFTEETWKQYCEKQRRMRL 540 K +D++A G ING P+ E D+D+ +D K WRKPGAD+SDYFNYGF E+TWK YCEKQ+R+R+ Sbjct: 137 KGVDLDAPGSINGVPLLEVDLDSFED-KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRM 197 The following BLAST results are available for this feature:
BLAST of TCONS_00051857 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|