Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00052695 ID=TCONS_00052695|Name=TCONS_00052695|organism=Clytia hemisphaerica|type=transcript|length=297bpRun BLAST on NCBI transcript from alignment at scaffold_218:241718..242014 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00052695 ID=TCONS_00052695|Name=TCONS_00052695|organism=Clytia hemisphaerica|type=transcript|length=297bp|location=Sequence derived from alignment at scaffold_218:241718..242014 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00052695 vs. Swiss-Prot (Human)
Match: ANGP4 (Angiopoietin-4 OS=Homo sapiens GN=ANGPT4 PE=1 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 4.531e-20 Identity = 39/78 (50.00%), Postives = 51/78 (65.38%), Query Frame = -3 Query: 62 IQEAGWGRSGVYTIEGANG-EISSILCDMTLLGGGWTTIQQRVDGSVSFARNWTAYKEGFGSTAGNFWYGNERIHNLT 292 IQ +G SGVYTI+ +N + + CD+ GG WT IQ+R +G+V+F RNW YK+GFG AG W GNE +H LT Sbjct: 294 IQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLT 371 The following BLAST results are available for this feature:
BLAST of TCONS_00052695 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|