Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00054417-protein ID=TCONS_00054417-protein|Name=TCONS_00054417-protein|organism=Clytia hemisphaerica|type=polypeptide|length=171bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00054417-protein vs. Swiss-Prot (Human)
Match: DNLZ (DNL-type zinc finger protein OS=Homo sapiens GN=DNLZ PE=1 SV=1) HSP 1 Score: 90.1225 bits (222), Expect = 3.856e-23 Identity = 43/88 (48.86%), Postives = 61/88 (69.32%), Query Frame = 0 Query: 86 IGKIEGTLY-LEFTCNVCEHRSSKTLSKQAYQSGVVLIRCEGCQNLHLIADNLGWFRD--NKVNIEDLMKEKGEEVKQLSVDD-LQFV 169 +G++E Y L +TC VC RSSK +SK AY GVV++ C GCQN H+IADNLGWF D K NIE+++ +GE+V +++ + L+ V Sbjct: 61 LGRVEAAHYQLVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELV 148 The following BLAST results are available for this feature:
BLAST of TCONS_00054417-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|